PaperBLAST – Find papers about a protein or its homologs

 

Align REBASE::M2.EcoF6699II to PF01170 (UPF0020)

REBASE::M2.EcoF6699II has 499 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence              Description
    ------- ------ -----    ------- ------ -----   ---- --  --------              -----------
    5.2e-14   38.5   0.0    1.3e-13   37.3   0.0    1.6  1  REBASE::M2.EcoF6699II  


Domain annotation for each sequence (and alignments):
>> REBASE::M2.EcoF6699II  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   37.3   0.0   1.3e-13   1.3e-13       8      55 ..      97     144 ..      93     183 .. 0.87

  Alignments for each domain:
  == domain 1  score: 37.3 bits;  conditional E-value: 1.3e-13
                            ---SS-HHHHHHHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--T CS
                UPF0020   8 gpapLketLAaalvrlagwkpgepllDPmCGsGtilIEaallganiap 55 
                            ++++ ++++A a++++  +kpg++ lDP+CGsGt l+E a lg +++ 
  REBASE::M2.EcoF6699II  97 YKGKFNPQVAKAILNIFAAKPGQTVLDPFCGSGTSLVECAHLGIDAIG 144
                            57899*************************************999884 PP



Or compare REBASE::M2.EcoF6699II to CDD or PaperBLAST