PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q54BW1 to PF01170 (UPF0020)

SwissProt::Q54BW1 has 561 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    2.5e-15   42.8   0.1    5.4e-13   35.2   0.1    3.5  2  SwissProt::Q54BW1  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q54BW1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   35.2   0.1   5.4e-13   5.4e-13      10     138 ..     258     437 ..     249     457 .. 0.71
   2 ?    1.4   0.0     0.013     0.013     139     185 ..     491     537 ..     487     545 .. 0.87

  Alignments for each domain:
  == domain 1  score: 35.2 bits;  conditional E-value: 5.4e-13
                        -SS-HHHHHHHHHH.........TT--TT.......S-EEETT-TTSHHHHHHHHHHTT--TTTT----SS................HHHHH CS
            UPF0020  10 apLketLAaalvrl.........agwkpg.......epllDPmCGsGtilIEaallganiapgllrefvle................lkaea 69 
                        ap++etLA+a+++          +g ++g       + + DP+ GsGt+  Ea  +  ++ p    + +                   ++ +
  SwissProt::Q54BW1 258 APIRETLASAIIMAiisstrrvgSGTTEGsyldlnkTNIWDPFVGSGTLIQEAISMLLKAKPSSCTNYKRSfqferfknhsterylkYLESI 349
                        6666666666665333322333344444411111115799**************999999886553333224557******99987777777 PP

                        HHHHHHH--...EEEEES-HHHHHHHHHHHHHTT-GG.GEEEEE--GGG--...............STTS---EEEE----------H CS
            UPF0020  70 eeearaelk...lygsDldrrvvqgareNaekagvgd.liefsqadaakLr...............lkegevdvivtnpPYGerlgsk 138
                        ++ + + +k   l+gsD+d+++++ +  N++k g ++  i+f + d++++                +++++  +i+tn+PYG r+ + 
  SwissProt::Q54BW1 350 NKPISPLIKntiLIGSDIDQKAIDSSIFNLSKQGYQHeNIKFFKGDFKSIYldqinidnsldddgdNNNNKPFTIITNLPYGTRVLNR 437
                        777775555667*********************9976269****9*9998766776667666665533444459*********98655 PP

  == domain 2  score: 1.4 bits;  conditional E-value: 0.013
                        HHHHHHHHHHHHHHHHH-TT..-EEEEEESSHHHHHCC---ESEEEE CS
            UPF0020 139 kalekLYseflrelkrvlrgggrlvlltsenkalekaleeralrkvk 185
                        k+l++L++ f++ +++  ++  r v+++++n+ ++++  ++  ++++
  SwissProt::Q54BW1 491 KDLRDLFKRFGDMIHESNESVLRDVFVLNGNSHFQSISTNNGKNNFE 537
                        67899***********999999*************999888776665 PP



Or compare SwissProt::Q54BW1 to CDD or PaperBLAST