PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q8TJK1 to PF01170 (UPF0020)

SwissProt::Q8TJK1 has 249 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.8e-13   36.8   0.0    2.8e-13   36.1   0.0    1.3  1  SwissProt::Q8TJK1  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q8TJK1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   36.1   0.0   2.8e-13   2.8e-13      77     128 ..      99     149 ..      87     170 .. 0.91

  Alignments for each domain:
  == domain 1  score: 36.1 bits;  conditional E-value: 2.8e-13
                        --EEEEES-HHHHHHHHHHHHHTT-GGGEEEEE--GGG--STTS---EEEE- CS
            UPF0020  77 lklygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtn 128
                         k++g+D+ +++v++a++Na+k+g +  +ef+q d+ +L+l++ +vdvi++n
  SwissProt::Q8TJK1  99 GKVIGVDMTQEMVKKAQDNARKYGYS-NVEFRQGDIEALPLDDRSVDVIISN 149
                        469*********************97.59***********9999*******9 PP



Or compare SwissProt::Q8TJK1 to CDD or PaperBLAST