VIMSS10082798 has 538 amino acids
Query: UPF0020 [M=197]
Accession: PF01170.22
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.4e-10 26.5 0.0 4.1e-10 25.8 0.0 1.3 1 VIMSS10082798
Domain annotation for each sequence (and alignments):
>> VIMSS10082798
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 25.8 0.0 4.1e-10 4.1e-10 75 132 .. 387 443 .. 359 493 .. 0.90
Alignments for each domain:
== domain 1 score: 25.8 bits; conditional E-value: 4.1e-10
UPF0020 75 aelklygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtnpPYG 132
+ ++++Dld++ ++ a+ Na +gv+d+i+f++ d+ +L + + +++ pP+G
VIMSS10082798 387 RSHYVIAIDLDPKKLDLAKHNAAIYGVADKIDFVKGDFFDLA-HNLKAGTVFLSPPWG 443
444599************************************.9999**********9 PP
Or compare VIMSS10082798 to CDD or PaperBLAST