PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10159234 to PF01170 (UPF0020)

VIMSS10159234 has 251 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    5.7e-10   25.3   0.0    2.2e-09   23.4   0.0    2.0  1  VIMSS10159234  


Domain annotation for each sequence (and alignments):
>> VIMSS10159234  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   23.4   0.0   2.2e-09   2.2e-09      75     125 ..      65     115 ..      34     117 .. 0.88

  Alignments for each domain:
  == domain 1  score: 23.4 bits;  conditional E-value: 2.2e-09
                    HH--EEEEES-HHHHHHHHHHHHHTT-GGGEEEEE--GGG--STTS---EE CS
        UPF0020  75 aelklygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvi 125
                    + ++++g+D+ r+++ ++re+a++agv+d+ief   daa L+ +++ +d++
  VIMSS10159234  65 EGANVVGLDISRAMMVQGREKARRAGVADRIEFLRGDAARLPFPDDHFDAV 115
                    445689************************************988899987 PP



Or compare VIMSS10159234 to CDD or PaperBLAST