PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS102529 to PF01170 (UPF0020)

VIMSS102529 has 253 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.22
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.9e-11   30.2   0.1    3.3e-11   29.3   0.1    1.4  1  VIMSS102529  


Domain annotation for each sequence (and alignments):
>> VIMSS102529  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   29.3   0.1   3.3e-11   3.3e-11      75     126 ..      59     110 ..      28     113 .. 0.85

  Alignments for each domain:
  == domain 1  score: 29.3 bits;  conditional E-value: 3.3e-11
      UPF0020  75 aelklygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdviv 126
                  +  ++ g+D++++++++a+eN ++ag++  i+++qa+a kL+ +++++d+++
  VIMSS102529  59 YGCHIQGVDINKKALEKAQENISAAGLESYIQVQQANAVKLPFDDNQFDIVL 110
                  445699************************************88889*9986 PP



Or compare VIMSS102529 to CDD or PaperBLAST