VIMSS102529 has 253 amino acids
Query: UPF0020 [M=197] Accession: PF01170.22 Description: Putative RNA methylase family UPF0020 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-11 30.2 0.1 3.3e-11 29.3 0.1 1.4 1 VIMSS102529 Domain annotation for each sequence (and alignments): >> VIMSS102529 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 29.3 0.1 3.3e-11 3.3e-11 75 126 .. 59 110 .. 28 113 .. 0.85 Alignments for each domain: == domain 1 score: 29.3 bits; conditional E-value: 3.3e-11 UPF0020 75 aelklygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdviv 126 + ++ g+D++++++++a+eN ++ag++ i+++qa+a kL+ +++++d+++ VIMSS102529 59 YGCHIQGVDINKKALEKAQENISAAGLESYIQVQQANAVKLPFDDNQFDIVL 110 445699************************************88889*9986 PP
Or compare VIMSS102529 to CDD or PaperBLAST