PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS115899 to PF01170 (UPF0020)

VIMSS115899 has 385 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      1e-57  181.2   0.0    1.4e-57  180.7   0.0    1.2  1  VIMSS115899  


Domain annotation for each sequence (and alignments):
>> VIMSS115899  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  180.7   0.0   1.4e-57   1.4e-57       1     195 [.     167     371 ..     167     373 .. 0.96

  Alignments for each domain:
  == domain 1  score: 180.7 bits;  conditional E-value: 1.4e-57
                  -SSS-SS---SS-HHHHHHHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SS............HHHHHHHHHHHH--..EEEEES CS
      UPF0020   1 RgyRefngpapLketLAaalvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvle............lkaeaeeearaelk..lygsDl 84 
                  RgyR  +g+ap+ke++Aaa+++l++w p++pl+DP CGsGt+ IEa ++++++apgl r+f++e            +++ea ++  +el+  ++g D+
  VIMSS115899 167 RGYRTEKGGAPIKENMAAAILQLSNWYPDKPLIDPTCGSGTFCIEAVMIARKMAPGLRRSFAFEewnwisdrliqeVRTEAAKKVDRELEldIMGCDI 264
                  9***********************************************************************99999999999888776667****** PP

                  -HHHHHHHHHHHHHTT-GGGEEEEE--GGG--STTS---EEEE----------HHHHHHHHHHHHHHHHHH-TT..-EEEEEESSHHHHHCC---ESE CS
      UPF0020  85 drrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtnpPYGerlgskkalekLYseflrelkrvlrgggrlvlltsenkalekaleeralr 182
                  d+r+v+ a+ Na+ agv++ i+f+q+ +++Lr +++ ++vi++npPYGerl++   + kLY e+++ ++  l++  ++ +++++++a+e+ ++++a +
  VIMSS115899 265 DARMVEIAKANAQVAGVAGDITFKQMRVQDLR-SDKINGVIISNPPYGERLSDDAGVTKLYAEMGQVFAP-LKT--WSKFILTSDEAFESKYGSQADK 358
                  ********************************.7779********************************9.999..********************** PP

                  EEEEEETTEEEEE CS
      UPF0020 183 kvkeknvklglll 195
                  k+k++n+ l+ +l
  VIMSS115899 359 KRKLYNGTLKVDL 371
                  *******998765 PP



Or compare VIMSS115899 to CDD or PaperBLAST