PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS12614 to PF01170 (UPF0020)

VIMSS12614 has 384 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    2.8e-68  215.6   0.0      4e-68  215.1   0.0    1.2  1  VIMSS12614  


Domain annotation for each sequence (and alignments):
>> VIMSS12614  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  215.1   0.0     4e-68     4e-68       1     196 [.     172     379 ..     172     380 .. 0.97

  Alignments for each domain:
  == domain 1  score: 215.1 bits;  conditional E-value: 4e-68
                 -SSS-SS---SS-HHHHHHHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SS.............HHHHHHHHHHHH--..EEEEES CS
     UPF0020   1 RgyRefngpapLketLAaalvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvle.............lkaeaeeearaelk..lygsDl 84 
                 RgyR++ g+apLketLA+al+++agw+p+ pl+DP+CGsGt+l+Ea+l++ niapg++++ +++             l+++a++ +r++l+  l+gsD 
  VIMSS12614 172 RGYRPALGNAPLKETLASALLTMAGWTPELPLYDPLCGSGTFLLEAGLQSLNIAPGKFQPGFCFqqwpdfdqdlwhsLLQTAKAGERDTLQapLWGSDG 270
                 9**************************************************************************************877778****** PP

                 -HHHHHHHHHHHHHTT-GGGEEEEE--GGG--STTS---EEEE----------HHHHHHHHHHHHHHHHHH-TT..-EEEEEESSHHHHHCC---ESEE CS
     UPF0020  85 drrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtnpPYGerlgskkalekLYseflrelkrvlrgggrlvlltsenkalekaleeralrk 183
                 dr+v+q+a++Na+++++g++i+++++++a+++ + +  +v+++npPYG+r+g+++al ++Y+++++ lk+++rg  ++++++s+nkal+k ++ r++++
  VIMSS12614 271 DREVIQAAKSNAQQCQLGGKIHWQKLNFADIE-PPAAEGVLICNPPYGKRIGQEEALGDFYQQIGDVLKQRFRG--WTAFVFSGNKALTKRIGLRTSAR 366
                 ********************************.666789***********************************..*********************** PP

                 EEEEETTEEEEEE CS
     UPF0020 184 vkeknvklglllk 196
                 ++++n+ l ++l 
  VIMSS12614 367 FPVNNGGLPCTLL 379
                 **********975 PP



Or compare VIMSS12614 to CDD or PaperBLAST