PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS139564 to PF01170 (UPF0020)

VIMSS139564 has 380 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      2e-70  222.6   0.0    4.3e-70  221.5   0.0    1.5  2  VIMSS139564  


Domain annotation for each sequence (and alignments):
>> VIMSS139564  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.8   0.0      0.23      0.23      61      83 ..      92     114 ..      75     122 .. 0.70
   2 !  221.5   0.0   4.3e-70   4.3e-70       1     194 [.     165     368 ..     165     370 .. 0.99

  Alignments for each domain:
  == domain 1  score: -2.8 bits;  conditional E-value: 0.23
                  --SSHHHHHHHHHHHH--EEEEE CS
      UPF0020  61 fvlelkaeaeeearaelklygsD 83 
                  +++++k ea++++ + ++++g+ 
  VIMSS139564  92 QTFKVKVEAKRANVKSIQFVGLT 114
                  34457888888888888888875 PP

  == domain 2  score: 221.5 bits;  conditional E-value: 4.3e-70
                  -SSS-SS---SS-HHHHHHHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SS............HHHHHHHHHH.HH--EEEEES- CS
      UPF0020   1 RgyRefngpapLketLAaalvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvle............lkaeaeeear.aelklygsDld 85 
                  RgyR ++g+apL+e+LAa+l+  ag++ ++p++DP+CGsGti+IEaa+++a++apg++r+f +e            l+++ae+++r ++++++gsD+d
  VIMSS139564 165 RGYRLDTGEAPLRENLAAGLLLSAGYDGTQPFQDPFCGSGTIAIEAAWIAARRAPGMMRRFGFEklqnfdktlwsdLRRRAEAQTRpVRAPIAGSDND 262
                  9*************************************************************************************99999******* PP

                  HHHHHHHHHHHHHTT-GGGEEEEE--GGG--STTS---EEEE----------HHHHHHHHHHHHHHHHHH-TT..-EEEEEESSHHHHHCC---ESEE CS
      UPF0020  86 rrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtnpPYGerlgskkalekLYseflrelkrvlrgggrlvlltsenkalekaleeralrk 183
                  rr+vq+a +Na++agv+d+++fs+ada+++r ++ge++++v+npPYG rl++ +al++LY++++++lk++++g  +l++++++++++ k+++ +  rk
  VIMSS139564 263 RRIVQTALDNARRAGVDDIVSFSVADAQSVR-PNGENGIMVSNPPYGVRLEEVRALQALYPQLGTWLKKHYAG--WLAAMFTGDREMPKFMCLSPKRK 357
                  *******************************.****************************************9..*********************** PP

                  EEEEETTEEEE CS
      UPF0020 184 vkeknvklgll 194
                  ++++n++++++
  VIMSS139564 358 IPLYNGNIDCR 368
                  *********97 PP



Or compare VIMSS139564 to CDD or PaperBLAST