VIMSS18898 has 545 amino acids
Query: UPF0020 [M=197]
Accession: PF01170.22
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.5e-11 28.2 0.0 2e-10 26.8 0.0 1.7 1 VIMSS18898
Domain annotation for each sequence (and alignments):
>> VIMSS18898
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 26.8 0.0 2e-10 2e-10 78 144 .. 160 224 .. 133 251 .. 0.85
Alignments for each domain:
== domain 1 score: 26.8 bits; conditional E-value: 2e-10
UPF0020 78 klygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtnpPYGerlgskkalekL 144
++yg D d+ +v+ +++ ++ d +++q+d+ +L+ + ++d i tnpP+G++ +++++ e++
VIMSS18898 160 NIYGYDTDAFAVALTKKRIKERYHLDCLNIVQKDFLNLK-HTPQFDCIFTNPPWGKKYNQNQK-ENF 224
49*************************************.8889*************988764.444 PP
Or compare VIMSS18898 to CDD or PaperBLAST