PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS18898 to PF01170 (UPF0020)

VIMSS18898 has 545 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    7.7e-11   28.2   0.0    2.1e-10   26.8   0.0    1.8  1  VIMSS18898  


Domain annotation for each sequence (and alignments):
>> VIMSS18898  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   26.8   0.0   2.1e-10   2.1e-10      78     145 ..     160     225 ..     133     252 .. 0.85

  Alignments for each domain:
  == domain 1  score: 26.8 bits;  conditional E-value: 2.1e-10
                 -EEEEES-HHHHHHHHHHHHHTT-GGGEEEEE--GGG--STTS---EEEE----------HHHHHHHH CS
     UPF0020  78 klygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtnpPYGerlgskkalekLY 145
                 ++yg D d+ +v+ +++  ++    d  +++q+d+ +L+  + ++d i tnpP+G++ +++++ e++ 
  VIMSS18898 160 NIYGYDTDAFAVALTKKRIKERYHLDCLNIVQKDFLNLK-HTPQFDCIFTNPPWGKKYNQNQK-ENFK 225
                 49*************************************.8889*************988764.4454 PP



Or compare VIMSS18898 to CDD or PaperBLAST