PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS198665 to PF01170 (UPF0020)

VIMSS198665 has 416 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    5.3e-11   28.7   0.0    1.2e-09   24.3   0.0    2.3  2  VIMSS198665  


Domain annotation for each sequence (and alignments):
>> VIMSS198665  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   24.3   0.0   1.2e-09   1.2e-09      25     118 ..      17     107 ..       6     118 .. 0.78
   2 ?    1.7   0.0      0.01      0.01     119     132 ..     223     236 ..     205     251 .. 0.82

  Alignments for each domain:
  == domain 1  score: 24.3 bits;  conditional E-value: 1.2e-09
                  T--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHHHH--EEEEES-HHHHHHHHHHHHHTT-GGGEEEEE--GGG--ST CS
      UPF0020  25 gwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeearaelklygsDldrrvvqgareNaekagvgdliefsqadaakLrlk 118
                  g+++g+++lDP+CG+Gt l+E   +g     g+  + + +  + ++++ r++  l      ++v + a + +++ g++d++ f + d+a+L+l+
  VIMSS198665  17 GLNEGSVILDPFCGTGTTLVESKRQGIPSL-GMEANPFAHFATSVKTDWRVDPDLLY-SHSWEVAELALDILRQQGIEDSVPFAA-DIADLPLR 107
                  7899*****************999999888.66666666677778888887777443.357889999999999999999999977.88888843 PP

  == domain 2  score: 1.7 bits;  conditional E-value: 0.01
                  TS---EEEE----- CS
      UPF0020 119 egevdvivtnpPYG 132
                   +++d+++t pPY 
  VIMSS198665 223 PQSIDAVITSPPYP 236
                  4599*********5 PP



Or compare VIMSS198665 to CDD or PaperBLAST