PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS2018297 to PF01170 (UPF0020)

VIMSS2018297 has 252 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
      4e-11   29.1   0.1    1.1e-10   27.7   0.1    1.6  1  VIMSS2018297  


Domain annotation for each sequence (and alignments):
>> VIMSS2018297  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   27.7   0.1   1.1e-10   1.1e-10      69     127 ..      52     110 ..      28     112 .. 0.83

  Alignments for each domain:
  == domain 1  score: 27.7 bits;  conditional E-value: 1.1e-10
                   HHHHHHHH--EEEEES-HHHHHHHHHHHHHTT-GGGEEEEE--GGG--STTS---EEEE CS
       UPF0020  69 aeeearaelklygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivt 127
                   +e ++r   k+ ++D+d+++++ a++ a  agv++li+f+ a+a kL+ +++++d+++ 
  VIMSS2018297  52 IELAQRFGCKITAVDMDAQALEVAKKSAGTAGVAHLISFERANAMKLPYQDASFDIVIN 110
                   4444556778**************************************9999****995 PP



Or compare VIMSS2018297 to CDD or PaperBLAST