PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS204294 to PF01170 (UPF0020)

VIMSS204294 has 388 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.8e-48  151.0   0.0    2.3e-48  150.6   0.0    1.1  1  VIMSS204294  


Domain annotation for each sequence (and alignments):
>> VIMSS204294  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  150.6   0.0   2.3e-48   2.3e-48       1     196 [.     176     383 ..     176     384 .. 0.92

  Alignments for each domain:
  == domain 1  score: 150.6 bits;  conditional E-value: 2.3e-48
                  -SSS-SS---SS-HHHHHHHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SS............HHHHHHHHHH.....HH--EEE CS
      UPF0020   1 RgyRefngpapLketLAaalvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvle............lkaeaeeear.....aelklyg 81 
                  RgyR + g apLke+LAa+l++l+gw+   pl+DP+CGsG +lIEa +++ + apgl r+f le               +a++++r     + ++++g
  VIMSS204294 176 RGYRAAMGAAPLKENLAAGLIQLTGWDGRMPLVDPFCGSGILLIEAVTMALQQAPGLGRQFGLEgwadfdrelwerE--HARARQRrrsdlDLAPVVG 271
                  9***********************************************************************99552..4444444345566666*** PP

                  EES-HHHHHHHHHHHHHTT-GGGEEEEE--GGG--STTS---EEEE----------HHHHHHHHHHHHHHHHHH-TT..-EEEEEESSHHHHHCC--- CS
      UPF0020  82 sDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtnpPYGerlgskkalekLYseflrelkrvlrgggrlvlltsenkalekaleer 179
                   + d+ + ++ar+N ++ag+++li++ +  + + +l+ g  +++v+npPYG r+gs+ +le+LY+ +++ + ++ +g  + + l+s+n +l+ al+ +
  VIMSS204294 272 YEQDPLIADQARDNIRAAGLDGLISIHSGSFEQQTLPPG-PGLLVCNPPYGHRVGSEDDLEQLYRLLGSFVREQASG--WQLWLLSGNASLTGALRLK 366
                  *****************************9999996675.89**************************999998777..******************* PP

                  ESEEEEEEETTEEEEEE CS
      UPF0020 180 alrkvkeknvklglllk 196
                  a+r++++ n+ +++++ 
  VIMSS204294 367 ASRRIPVSNGGIDCRWL 383
                  **************985 PP



Or compare VIMSS204294 to CDD or PaperBLAST