PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS2092704 to PF01170 (UPF0020)

VIMSS2092704 has 495 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    3.7e-12   32.5   0.1    2.5e-10   26.5   0.1    2.7  2  VIMSS2092704  


Domain annotation for each sequence (and alignments):
>> VIMSS2092704  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   26.5   0.1   2.5e-10   2.5e-10      17     131 ..     191     287 ..     186     308 .. 0.61
   2 ?   -3.2   0.0      0.31      0.31     148     179 ..     319     350 ..     317     358 .. 0.77

  Alignments for each domain:
  == domain 1  score: 26.5 bits;  conditional E-value: 2.5e-10
                   HHHHHHHTT--TTS-EEETT-TTSHHHHHHHHH.HTT--TTTT----SSHHHHHHHHHHHH--EEEEES-HHHHHHHHHHHHHTT-GGGEEEEE.-- CS
       UPF0020  17 AaalvrlagwkpgepllDPmCGsGtilIEaall.ganiapgllrefvlelkaeaeeearaelklygsDldrrvvqgareNaekagvgdliefsq.ad 111
                   ++ l +l ++k+g+ ++DP CGsG++lI aa   g+n  ++  +           e++ ++ +l+ +++          N+ + ++gd+i     ++
  VIMSS2092704 191 SSLLAMLVQAKDGDEIYDPTCGSGSLLIKAAKEiGSNNFAIYGQ-----------ERNSTTHSLCRMNMFLH-----DINDANIQLGDTIRNPRiLE 271
                   566889999**********************7515555543332...........22223333333333333.....33445555555554433033 PP

                   GGG--STTS---EEEE---- CS
       UPF0020 112 aakLrlkegevdvivtnpPY 131
                   + kL+    ++dv+v+npP+
  VIMSS2092704 272 NDKLK----KFDVVVANPPF 287
                   33444....57777777777 PP

  == domain 2  score: -3.2 bits;  conditional E-value: 0.31
                   HHHHHHHH-TT..-EEEEEESSHHHHHCC--- CS
       UPF0020 148 flrelkrvlrgggrlvlltsenkalekaleer 179
                   f + +   l+++gr+++++++   +  a+e +
  VIMSS2092704 319 FIQHMLASLNESGRMAVVVPHGVLFRGAAEGK 350
                   77888888999999999999888877777655 PP



Or compare VIMSS2092704 to CDD or PaperBLAST