PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS2093544 to PF01170 (UPF0020)

VIMSS2093544 has 284 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.5e-11   30.5   0.2    3.4e-11   29.3   0.2    1.7  1  VIMSS2093544  


Domain annotation for each sequence (and alignments):
>> VIMSS2093544  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   29.3   0.2   3.4e-11   3.4e-11      75     132 ..     138     193 ..     101     206 .. 0.88

  Alignments for each domain:
  == domain 1  score: 29.3 bits;  conditional E-value: 3.4e-11
                   HH--EEEEES-HHHHHHHHHHHHHTT-GGGEEEEE--GGG--STTS---EEEE----- CS
       UPF0020  75 aelklygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtnpPYG 132
                   a+ +++++Dl ++ ++ a++Na++ ++++   +++   ++L   ++++d+iv+npPY 
  VIMSS2093544 138 ANSQVVAVDLYQQSLDVAKKNAQANNITNVKFIQSSWYTNLD--TDKFDIIVSNPPYI 193
                   66789******************************9*****9..558**********6 PP



Or compare VIMSS2093544 to CDD or PaperBLAST