VIMSS2124107 has 251 amino acids
Query: UPF0020 [M=197]
Accession: PF01170.22
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2e-12 33.3 0.2 3e-12 32.7 0.2 1.2 1 VIMSS2124107
Domain annotation for each sequence (and alignments):
>> VIMSS2124107
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 32.7 0.2 3e-12 3e-12 69 127 .. 54 112 .. 29 114 .. 0.81
Alignments for each domain:
== domain 1 score: 32.7 bits; conditional E-value: 3e-12
UPF0020 69 aeeearaelklygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivt 127
++ ++++ ++ g+Dld++++++ar+N ++ +++d+i+++ a+a+kL+ +++++d+++
VIMSS2124107 54 IQIAKQYGCHITGIDLDEEALDKARSNIKENNLEDFIQVQRANATKLPFEDNSFDIVIN 112
3333336666**************************************7777****995 PP
Or compare VIMSS2124107 to CDD or PaperBLAST