PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS250208 to PF01170 (UPF0020)

VIMSS250208 has 248 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.9e-12   31.6   0.0    1.1e-11   30.9   0.0    1.3  1  VIMSS250208  


Domain annotation for each sequence (and alignments):
>> VIMSS250208  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   30.9   0.0   1.1e-11   1.1e-11      76     128 ..      97     148 ..      87     172 .. 0.91

  Alignments for each domain:
  == domain 1  score: 30.9 bits;  conditional E-value: 1.1e-11
                  H--EEEEES-HHHHHHHHHHHHHTT-GGGEEEEE--GGG--STTS---EEEE- CS
      UPF0020  76 elklygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtn 128
                    k++g+D+  ++v++a+ Na+k+g +  +ef+  d+ +L+ k+++vdvi++n
  VIMSS250208  97 SGKVIGVDMTLEMVEKAQANARKYGYS-NVEFRHGDIESLPVKDSSVDVIISN 148
                  5579*********************97.59***********9999*******9 PP



Or compare VIMSS250208 to CDD or PaperBLAST