PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS274959 to PF01170 (UPF0020)

VIMSS274959 has 384 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.4e-60  188.3   0.0    8.9e-60  187.9   0.0    1.2  1  VIMSS274959  


Domain annotation for each sequence (and alignments):
>> VIMSS274959  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  187.9   0.0   8.9e-60   8.9e-60       1     195 [.     167     371 ..     167     373 .. 0.97

  Alignments for each domain:
  == domain 1  score: 187.9 bits;  conditional E-value: 8.9e-60
                  -SSS-SS---SS-HHHHHHHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SS............HHHHHHHHHHHH--..EEEEES CS
      UPF0020   1 RgyRefngpapLketLAaalvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvle............lkaeaeeearaelk..lygsDl 84 
                  RgyR  +g+ap+ke++Aaa+++l++w p++pl+DP CGsGt+ IEaa++g niapg++r+f++e            +++eae +a++++   + g+Dl
  VIMSS274959 167 RGYRAEKGGAPIKENMAAAIIQLSNWFPDKPLIDPTCGSGTFCIEAAMIGMNIAPGFNRDFAFEawpwvdqsqvqkVRDEAESKANYDIDldISGFDL 264
                  9*************************************************************************************777667****** PP

                  -HHHHHHHHHHHHHTT-GGGEEEEE--GGG--STTS---EEEE----------HHHHHHHHHHHHHHHHHH-TT..-EEEEEESSHHHHHCC---ESE CS
      UPF0020  85 drrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtnpPYGerlgskkalekLYseflrelkrvlrgggrlvlltsenkalekaleeralr 182
                  d r+v+ ar+Nae+ag+gd i+++q+  ++L+ +++ ++vi++npPYGerl + ka++ LY+e++++++  l++  ++ +++++++ +ek ++++a +
  VIMSS274959 265 DGRMVEIARKNAEEAGLGDVIKLKQMRLQDLK-TDKINGVIISNPPYGERLLDDKAVDILYNEMGQTFAP-LKT--WSKFILTSDEGFEKKYGSQADK 358
                  ********************************.7779*********************************.999..********************** PP

                  EEEEEETTEEEEE CS
      UPF0020 183 kvkeknvklglll 195
                  k+k++n+ l+ +l
  VIMSS274959 359 KRKLYNGTLKVDL 371
                  *******998765 PP



Or compare VIMSS274959 to CDD or PaperBLAST