PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS30550 to PF01170 (UPF0020)

VIMSS30550 has 364 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    6.3e-46  142.7   0.0    6.5e-45  139.4   0.0    2.2  1  VIMSS30550  


Domain annotation for each sequence (and alignments):
>> VIMSS30550  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  139.4   0.0   6.5e-45   6.5e-45       1     195 [.     189     357 ..     189     359 .. 0.97

  Alignments for each domain:
  == domain 1  score: 139.4 bits;  conditional E-value: 6.5e-45
                 -SSS-SS---SS-HHHHHHHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHHHH--EEEEES-HHHHHHHHHHHHHT CS
     UPF0020   1 RgyRefngpapLketLAaalvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeearaelklygsDldrrvvqgareNaeka 99 
                 R +R++++pa+Lk+++A al++la++++g +++DP+CGsGti+IE al g +                          ++++++ +++++ga+ Na +a
  VIMSS30550 189 RPWRVYDHPAHLKASIANALIELAEVEDGASFIDPFCGSGTIPIELALRGYQGR------------------------IICLEKFAKHLNGAKMNALAA 263
                 78************************************************9999........................9******************** PP

                 T-GGGEEEEE--GGG--STTS---EEEE----------HHHHHHHHHHHHHHHHHH-TT..-EEEEEESSHHHHHCC---ESEEEEEEETTEEEEE CS
     UPF0020 100 gvgdliefsqadaakLrlkegevdvivtnpPYGerlgskkalekLYseflrelkrvlrgggrlvlltsenkalekaleeralrkvkeknvklglll 195
                 gv d+ief + da+ L +  +evd  v+n+PYG ++g+k ++ +LY+ f +el++vl++  r v++t+e++a+eka+ee  ++ ++ + + +g+l+
  VIMSS30550 264 GVFDKIEFIKGDARRLSKYVDEVDFAVSNLPYGLKIGRKSMIPSLYERFFDELSKVLQK--RGVFITTEKEAIEKAIEEVGFKITHYRIIGHGGLR 357
                 *****************8899**************************************..*******************9999999888888776 PP



Or compare VIMSS30550 to CDD or PaperBLAST