PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS36497 to PF01170 (UPF0020)

VIMSS36497 has 518 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    5.3e-11   28.7   0.1    3.2e-10   26.1   0.0    2.2  2  VIMSS36497  


Domain annotation for each sequence (and alignments):
>> VIMSS36497  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   26.1   0.0   3.2e-10   3.2e-10      76     139 ..     156     218 ..     146     227 .. 0.84
   2 ?   -1.2   0.0     0.075     0.075     137     177 ..     427     467 ..     421     475 .. 0.80

  Alignments for each domain:
  == domain 1  score: 26.1 bits;  conditional E-value: 3.2e-10
                 H--EEEEES-HHHHHHHHHHHHHTT-GGGEEEEE--.GGG--STTS---EEEE----------HH CS
     UPF0020  76 elklygsDldrrvvqgareNaekagvgdliefsqad.aakLrlkegevdvivtnpPYGerlgskk 139
                 + ++++ D+   +++ a++N  k++v+d+i++   + + kL   ++++d iv+npPY   +++ k
  VIMSS36497 156 NTNIIATDISVDAIKVAKSNSIKYNVTDRIQIIHSNwFEKLD--KQKFDFIVSNPPYISHTEKLK 218
                 45699**************************99887356676..568**********88777655 PP

  == domain 2  score: -1.2 bits;  conditional E-value: 0.075
                 -HHHHHHHHHHHHHHHHHH-TT..-EEEEEESSHHHHHCC- CS
     UPF0020 137 skkalekLYseflrelkrvlrgggrlvlltsenkalekale 177
                 +kk+++ + +e l+ l++ l+++g lv++   ++ + +a++
  VIMSS36497 427 KKKKKRIFNKERLKILQNKLKNNGNLVFASDIENYFYEAMA 467
                 34555777889999999999999999999888888877775 PP



Or compare VIMSS36497 to CDD or PaperBLAST