PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS502142 to PF01170 (UPF0020)

VIMSS502142 has 251 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.4e-10   25.1   0.0    1.6e-09   23.8   0.0    1.7  2  VIMSS502142  


Domain annotation for each sequence (and alignments):
>> VIMSS502142  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   23.8   0.0   1.6e-09   1.6e-09      75     140 ..     108     171 ..      72     180 .. 0.83
   2 ?   -3.8   0.0      0.47      0.47      16      26 ..     221     231 ..     208     235 .. 0.62

  Alignments for each domain:
  == domain 1  score: 23.8 bits;  conditional E-value: 1.6e-09
                  HH--EEEEES-HHHHHHHHHHHHHTT-GGGEEEEE--GGG--STTS---EEEE----------HHH CS
      UPF0020  75 aelklygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtnpPYGerlgskka 140
                  +++++ + Dl +++++ a+ Na++ g   +  + ++  a L+ +++ +d+iv+npPY  r +++ a
  VIMSS502142 108 PQAEVTATDLSAAALAVAEGNAQRLGARVRCLAGDWYEA-LP-AQDRYDLIVSNPPYIAREDAHLA 171
                  567799*****************************9877.**.7779**********998777655 PP

  == domain 2  score: -3.8 bits;  conditional E-value: 0.47
                  HHHHHHHHTT- CS
      UPF0020  16 LAaalvrlagw 26 
                   A+al+r ag+
  VIMSS502142 221 AARALLRQAGL 231
                  35666666655 PP



Or compare VIMSS502142 to CDD or PaperBLAST