VIMSS502142 has 251 amino acids
Query: UPF0020 [M=197] Accession: PF01170.22 Description: Putative RNA methylase family UPF0020 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-10 25.5 0.0 1.3e-09 24.2 0.0 1.7 2 VIMSS502142 Domain annotation for each sequence (and alignments): >> VIMSS502142 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 24.2 0.0 1.3e-09 1.3e-09 75 140 .. 108 171 .. 72 179 .. 0.83 2 ? -3.7 0.0 0.45 0.45 16 26 .. 221 231 .. 208 235 .. 0.63 Alignments for each domain: == domain 1 score: 24.2 bits; conditional E-value: 1.3e-09 UPF0020 75 aelklygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtnpPYGerlgskka 140 +++++ + Dl +++++ a+ Na++ g + + ++ a L+ +++ +d+iv+npPY r +++ a VIMSS502142 108 PQAEVTATDLSAAALAVAEGNAQRLGARVRCLAGDWYEA-LP-AQDRYDLIVSNPPYIAREDAHLA 171 567799*****************************9877.**.7779**********998777655 PP == domain 2 score: -3.7 bits; conditional E-value: 0.45 UPF0020 16 LAaalvrlagw 26 A+al+r ag+ VIMSS502142 221 AARALLRQAGL 231 46666666665 PP
Or compare VIMSS502142 to CDD or PaperBLAST