PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS54360 to PF01170 (UPF0020)

VIMSS54360 has 793 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    1.9e-10   26.9   0.0    5.3e-09   22.2   0.0    2.7  2  VIMSS54360  


Domain annotation for each sequence (and alignments):
>> VIMSS54360  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   22.2   0.0   5.3e-09   5.3e-09      32     141 ..     227     320 ..     224     323 .. 0.74
   2 ?    0.9   0.0     0.017     0.017      79     113 ..     721     755 ..     691     771 .. 0.71

  Alignments for each domain:
  == domain 1  score: 22.2 bits;  conditional E-value: 5.3e-09
                 EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHHHH--EEEEES-HHHHHHHHHHHHHTT.-GGGEEEEE--GGG--STTS---EEEE-- CS
     UPF0020  32 llDPmCGsGtilIEaallganiapgllrefvlelkaeaeeearaelklygsDldrrvvqgareNaekag.vgdliefsqadaakLrlkegevdvivtnp 129
                  +DP CGsG++l E    +++ +p  +                +++ lyg +++ +  + +++     g   + i + +   ++   +++ +d +++np
  VIMSS54360 227 VYDPACGSGGMLTETQNFVEEKYPASN----------------RDIYLYGKEINDETYAICKSDMMIKGnNPENIRVGSTLSTDEF-SSNRFDFMLSNP 308
                 79**************99999998555................5667888888888888888776544313445555444444323.4558******** PP

                 --------HHHH CS
     UPF0020 130 PYGerlgskkal 141
                 PYG++  s+++ 
  VIMSS54360 309 PYGKSWASEQKH 320
                 *****9998865 PP

  == domain 2  score: 0.9 bits;  conditional E-value: 0.017
                 EEEEES-HHHHHHHHHHHHHTT-GGGEEEEE--GG CS
     UPF0020  79 lygsDldrrvvqgareNaekagvgdliefsqadaa 113
                  y +D  + +v+ a  N+e+ ++g +i+f++   +
  VIMSS54360 721 QYFLDEVKPHVDEAWINLESVKIGYEISFNKYFYR 755
                 56678889999999999999999999999886443 PP



Or compare VIMSS54360 to CDD or PaperBLAST