PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5567242 to PF01170 (UPF0020)

VIMSS5567242 has 374 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    9.9e-61  191.0   0.0    1.4e-60  190.5   0.0    1.2  1  VIMSS5567242  


Domain annotation for each sequence (and alignments):
>> VIMSS5567242  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  190.5   0.0   1.4e-60   1.4e-60       1     196 [.     161     367 ..     161     368 .. 0.96

  Alignments for each domain:
  == domain 1  score: 190.5 bits;  conditional E-value: 1.4e-60
                   -SSS-SS---SS-HHHHHHHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SS............HHHHHHHHHH..HH--EEEEE CS
       UPF0020   1 RgyRefngpapLketLAaalvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvle............lkaeaeeear..aelklygsD 83 
                   RgyR ++g+ap+ketLAaal+rla+w+ ++pl+DP+CGsGti+IEa+l+++niapg++r+fv+e            l++ea ++a   +e+++y+ D
  VIMSS5567242 161 RGYRLAQGEAPIKETLAAALIRLANWNGNTPLIDPFCGSGTIAIEACLIAQNIAPGFNRSFVSEtwdimpeglydtLRDEADQQADydKEVEVYAYD 257
                   9**********************************************************************************999767777***** PP

                   S-HHHHHHHHHHHHHTT-GGGEEEEE--GGG--STTS---EEEE----------HHHHHHHHHHHHHHHHHH-TT..-EEEEEESSHHHHHCC---E CS
       UPF0020  84 ldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtnpPYGerlgskkalekLYseflrelkrvlrgggrlvlltsenkalekaleera 180
                   +d+++v+ a++Nae+ g+g+ i+f+++d+  L   +++  ++++npPYGer+g+  ++e++Y+ +++ +k++ +    + +++++nk++e + +++a
  VIMSS5567242 258 IDPEMVEIAKRNAEEVGLGEVIHFEVKDVNTLDIHTDKPIALIGNPPYGERIGDRDEVEEMYRYLGKLMKEHPNL---SEYILTSNKEFEFLTQRKA 351
                   *********************************7777777*******************************7766...8899*************** PP

                   SEEEEEEETTEEEEEE CS
       UPF0020 181 lrkvkeknvklglllk 196
                   ++++k++n++++++++
  VIMSS5567242 352 TKRRKLFNGYIECTYY 367
                   *************986 PP



Or compare VIMSS5567242 to CDD or PaperBLAST