PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5814385 to PF01170 (UPF0020)

VIMSS5814385 has 517 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
      2e-12   33.3   0.0    3.1e-12   32.7   0.0    1.3  1  VIMSS5814385  


Domain annotation for each sequence (and alignments):
>> VIMSS5814385  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   32.7   0.0   3.1e-12   3.1e-12      19     146 ..     201     322 ..     196     375 .. 0.82

  Alignments for each domain:
  == domain 1  score: 32.7 bits;  conditional E-value: 3.1e-12
                   HHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHH...HH--EEEEES-HHHHHHHHHHHHHTT-GGG.EEEEE-- CS
       UPF0020  19 alvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeear...aelklygsDldrrvvqgareNaekagvgdl.iefsqad 111
                    +v+l + + ++++ DP  G+ ++l+E a   ++       e+ ++      +e+r   ++  + g D d+ +++ +  N  + gv++  +e+++  
  VIMSS5814385 201 MIVELMNPQVTDKICDPAAGTAGFLVESAEFLQDKKK----EE-IFYN----KENRhyfHNEMFTGYDTDQTMLRIGAMNMLSHGVDNPnVEYQDSL 288
                   58999************************99998882....22.2222....222222344449**********************98637777766 PP

                   GGG--STTS---EEEE----------HHHHHHHHH CS
       UPF0020 112 aakLrlkegevdvivtnpPYGerlgskkalekLYs 146
                     + + +++e+ +i +npP+  +l+ +   ++L +
  VIMSS5814385 289 SEQNT-DRDEYSLIMANPPFKGSLDYNSVSKDLLK 322
                   66666.888***********999988777776655 PP



Or compare VIMSS5814385 to CDD or PaperBLAST