PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5973 to PF01170 (UPF0020)

VIMSS5973 has 363 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence  Description
    ------- ------ -----    ------- ------ -----   ---- --  --------  -----------
    3.8e-43  133.6   0.0    5.9e-42  129.7   0.0    2.1  1  VIMSS5973  


Domain annotation for each sequence (and alignments):
>> VIMSS5973  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  129.7   0.0   5.9e-42   5.9e-42       1     195 [.     190     356 ..     190     358 .. 0.96

  Alignments for each domain:
  == domain 1  score: 129.7 bits;  conditional E-value: 5.9e-42
                -SSS-SS---SS-HHHHHHHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHHHH--EEEEES-HHHHHHHHHHHHHTT CS
    UPF0020   1 RgyRefngpapLketLAaalvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeearaelklygsDldrrvvqgareNaekag 100
                R +R++++pa+Lk+++A al++la  +p+ +++DP+CGsGti+IE al g +                          ++++++ +++++ga+ Na +ag
  VIMSS5973 190 RPWRVYDHPAHLKSSIANALIELA--QPEGSFIDPFCGSGTIPIELALRGYEGK------------------------IICLEKYHKHLNGAKMNALAAG 263
                78*********************8..6899******************999888........................9********************* PP

                -GGGEEEEE--GGG--STTS---EEEE----------HHHHHHHHHHHHHHHHHH-TT..-EEEEEESSHHHHHCC---ESEEEEEEETTEEEEE CS
    UPF0020 101 vgdliefsqadaakLrlkegevdvivtnpPYGerlgskkalekLYseflrelkrvlrgggrlvlltsenkalekaleeralrkvkeknvklglll 195
                v d+ief   da+ L +  ++vd  v+n+PYG ++g+  ++ +LYs+fl+el++vl++  r v++t+e++a+e+a+ee+ ++ ++ + + +g+l+
  VIMSS5973 264 VYDKIEFILGDATRLSEYLESVDFAVSNLPYGLKIGRRSMIPELYSKFLSELAKVLEK--RGVFITTEKNAIERAIEENGFKIIHHRLIGHGGLR 356
                ****************8888**************************************..***********************999998888876 PP



Or compare VIMSS5973 to CDD or PaperBLAST