PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6458 to PF01170 (UPF0020)

VIMSS6458 has 251 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence  Description
    ------- ------ -----    ------- ------ -----   ---- --  --------  -----------
    1.1e-10   27.6   0.1      2e-10   26.8   0.1    1.4  1  VIMSS6458  


Domain annotation for each sequence (and alignments):
>> VIMSS6458  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   26.8   0.1     2e-10     2e-10      78     127 ..      63     112 ..      31     114 .. 0.86

  Alignments for each domain:
  == domain 1  score: 26.8 bits;  conditional E-value: 2e-10
                -EEEEES-HHHHHHHHHHHHHTT-GGGEEEEE--GGG--STTS---EEEE CS
    UPF0020  78 klygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivt 127
                ++ g+Dld++++++a+ N e+ g++++i+++ a+a kL+ +++++d+++ 
  VIMSS6458  63 HIEGVDLDENALAKAQANIEANGLQEKIHVQRANAMKLPFEDESFDIVIN 112
                488************************************7777****995 PP



Or compare VIMSS6458 to CDD or PaperBLAST