PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS737167 to PF01170 (UPF0020)

VIMSS737167 has 430 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    4.2e-49  153.0   0.0    5.7e-43  133.0   0.0    2.3  2  VIMSS737167  


Domain annotation for each sequence (and alignments):
>> VIMSS737167  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  133.0   0.0   5.7e-43   5.7e-43       1     137 [.     174     327 ..     174     332 .. 0.91
   2 !   17.8   0.0   1.2e-07   1.2e-07     134     195 ..     351     410 ..     349     412 .. 0.91

  Alignments for each domain:
  == domain 1  score: 133.0 bits;  conditional E-value: 5.7e-43
                  -SSS-SS---SS-HHHHHHHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SS...............HHHHHHHHHH...HH--EE CS
      UPF0020   1 RgyRefngpapLketLAaalvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvle...............lkaeaeeear...aelkly 80 
                  Rg+R ++g apL+e+LAa+++rlagw+pg+pl+DPmCGsGt+  Eaa+++  +apg  r+f +e               +   a+++ar   ++l ++
  VIMSS737167 174 RGWRLDKGAAPLRENLAAGILRLAGWTPGTPLYDPMCGSGTFVAEAAQIALGVAPGVERRFGFEklkqyditawqtlkvAAMDAKRAARgkrDDLLIF 271
                  9**************************************************************************988733444444444437777** PP

                  EEES-HHHHHHHHHHHHHTT-GGGEEEEE--GGG--STTS---EEEE---------- CS
      UPF0020  81 gsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtnpPYGerlgs 137
                  gsD+   ++++ar N+e+agv  l+ ++q da++++ + +  +vivtnpPYGer++ 
  VIMSS737167 272 GSDISGDMLEKARANLERAGVPSLW-LKQIDARNMTPPAAAPGVIVTNPPYGERIEV 327
                  **********************999.5788******888899************985 PP

  == domain 2  score: 17.8 bits;  conditional E-value: 1.2e-07
                  ----HHHHHHHHHHHHHHHHHH-TT..-EEEEEESSHHHHHCC---ESEEEEEEETTEEEEE CS
      UPF0020 134 rlgskkalekLYseflrelkrvlrgggrlvlltsenkalekaleeralrkvkeknvklglll 195
                  r+++     +++++++++lk++++g  + ++++s++++l   l+ r+++k++++n+ l+++l
  VIMSS737167 351 RTHADSPDSEFFRALGDALKQRFAG--WQAFMLSSDRTLPGQLRLRESAKTPLFNGALECRL 410
                  66666667899**************..*******************************9975 PP



Or compare VIMSS737167 to CDD or PaperBLAST