VIMSS752539 has 212 amino acids
Query: UPF0020 [M=197]
Accession: PF01170.22
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7e-12 31.5 0.1 1.5e-11 30.5 0.1 1.6 1 VIMSS752539
Domain annotation for each sequence (and alignments):
>> VIMSS752539
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 30.5 0.1 1.5e-11 1.5e-11 67 132 .. 69 133 .. 45 174 .. 0.87
Alignments for each domain:
== domain 1 score: 30.5 bits; conditional E-value: 1.5e-11
UPF0020 67 aeaeeearaelklygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtnpPYG 132
a + ar+ k++++++d+ ++ a++Na+ +gv++li+f+ d+ ++ +e + d+++ +pP+G
VIMSS752539 69 GSAIALARTGKKVIAIEMDSVRLAMAKNNARVYGVEHLITFVHGDFFDVA-AEIKADAVLIDPPWG 133
55666677778899************************************.8889**********9 PP
Or compare VIMSS752539 to CDD or PaperBLAST