VIMSS755798 has 212 amino acids
Query: UPF0020 [M=197] Accession: PF01170.22 Description: Putative RNA methylase family UPF0020 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.1e-12 31.5 0.1 2.1e-11 30.0 0.1 1.6 1 VIMSS755798 Domain annotation for each sequence (and alignments): >> VIMSS755798 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.0 0.1 2.1e-11 2.1e-11 67 132 .. 69 133 .. 45 141 .. 0.86 Alignments for each domain: == domain 1 score: 30.0 bits; conditional E-value: 2.1e-11 UPF0020 67 aeaeeearaelklygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtnpPYG 132 a + ar+ k++++++d+ ++ a++Na+ +gv++li+f+ d+ ++ +e + d+++ +pP+G VIMSS755798 69 GSAIALARTGKKVIAIEMDSVRLAMAKNNARVYGVEHLITFVHGDFFDVA-AEIKADAVLIDPPWG 133 55666777778899************************************.8889**********9 PP
Or compare VIMSS755798 to CDD or PaperBLAST