PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS852169 to PF01170 (UPF0020)

VIMSS852169 has 484 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    7.3e-13   34.8   0.0    1.4e-12   33.9   0.0    1.4  1  VIMSS852169  


Domain annotation for each sequence (and alignments):
>> VIMSS852169  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   33.9   0.0   1.4e-12   1.4e-12      19     146 ..     170     290 ..     165     347 .. 0.77

  Alignments for each domain:
  == domain 1  score: 33.9 bits;  conditional E-value: 1.4e-12
                  HHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHHHH--EEEEES-HHHHHHHHHHHHHTT-GG.GEEEEE--GGG- CS
      UPF0020  19 alvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeearaelklygsDldrrvvqgareNaekagvgd.liefsqadaakL 115
                   +v+l + +p++ ++DP  Gs ++l+ a+   ++    l+      l + ++e++++   +yg+D+dr +++ +  N    g+++  ie+++    + 
  VIMSS852169 170 MMVELMKPTPEDIIVDPAAGSAGFLVAAGEYLRKHRSDLF------LVQSLKEHFNN-HMFYGFDMDRTMLRIGAMNMMLHGIENpNIEYRDSLSEQN 260
                  69***************************99888885444......66777766665.459**********************983599999888887 PP

                  -STTS---EEEE----------HHHHHHHHH CS
      UPF0020 116 rlkegevdvivtnpPYGerlgskkalekLYs 146
                  + +++++ ++++npP+  +l+     ++L +
  VIMSS852169 261 K-DKDKYTLVLANPPFKGSLDYDAVSNDLLK 290
                  7.8889**********999987766666654 PP



Or compare VIMSS852169 to CDD or PaperBLAST