PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS858280 to PF01170 (UPF0020)

VIMSS858280 has 251 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.2e-10   27.5   0.1    2.1e-10   26.7   0.1    1.4  1  VIMSS858280  


Domain annotation for each sequence (and alignments):
>> VIMSS858280  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   26.7   0.1   2.1e-10   2.1e-10      78     127 ..      63     112 ..      33     114 .. 0.87

  Alignments for each domain:
  == domain 1  score: 26.7 bits;  conditional E-value: 2.1e-10
                  -EEEEES-HHHHHHHHHHHHHTT-GGGEEEEE--GGG--STTS---EEEE CS
      UPF0020  78 klygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivt 127
                  ++ g+Dld++++++a+ N e+ g++++i+++ a+a kL+ +++++d+++ 
  VIMSS858280  63 HIEGVDLDENALAKAQANIEANGLQEKIHVQRANAMKLPFEDESFDIVIN 112
                  488************************************7777****995 PP



Or compare VIMSS858280 to CDD or PaperBLAST