VIMSS858280 has 251 amino acids
Query: UPF0020 [M=197]
Accession: PF01170.22
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.1e-10 27.6 0.1 1.9e-10 26.8 0.1 1.4 1 VIMSS858280
Domain annotation for each sequence (and alignments):
>> VIMSS858280
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 26.8 0.1 1.9e-10 1.9e-10 78 127 .. 63 112 .. 33 114 .. 0.87
Alignments for each domain:
== domain 1 score: 26.8 bits; conditional E-value: 1.9e-10
UPF0020 78 klygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivt 127
++ g+Dld++++++a+ N e+ g++++i+++ a+a kL+ +++++d+++
VIMSS858280 63 HIEGVDLDENALAKAQANIEANGLQEKIHVQRANAMKLPFEDESFDIVIN 112
488************************************7777****995 PP
Or compare VIMSS858280 to CDD or PaperBLAST