PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS912936 to PF01170 (UPF0020)

VIMSS912936 has 381 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.8e-62  196.7   0.0    2.6e-62  196.2   0.0    1.2  1  VIMSS912936  


Domain annotation for each sequence (and alignments):
>> VIMSS912936  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  196.2   0.0   2.6e-62   2.6e-62       1     196 [.     161     367 ..     161     368 .. 0.96

  Alignments for each domain:
  == domain 1  score: 196.2 bits;  conditional E-value: 2.6e-62
                  -SSS-SS---SS-HHHHHHHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SS............HHHHHHHHHH..HH--EEEEES CS
      UPF0020   1 RgyRefngpapLketLAaalvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvle............lkaeaeeear..aelklygsDl 84 
                  RgyR ++g+ap+ketLAa+l+rla+wk ++pl+DP+CGsGti+IEa+l+++niapg++refv+e             ++ea + a   +e+++y+sD+
  VIMSS912936 161 RGYRLAQGEAPIKETLAASLIRLANWKGDTPLIDPFCGSGTIAIEACLIAQNIAPGFNREFVSEqwnimpaniyddYRDEADKMADydKEIEVYASDI 258
                  9***************************************************************************9999999999778888****** PP

                  -HHHHHHHHHHHHHTT-GGGEEEEE--GGG--STTS---EEEE----------HHHHHHHHHHHHHHHHHH-TT..-EEEEEESSHHHHHCC---ESE CS
      UPF0020  85 drrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtnpPYGerlgskkalekLYseflrelkrvlrgggrlvlltsenkalekaleeralr 182
                  d+++v+ a++Nae+ g++d+i+fs++d+  L+ +++e  ++++npPYGer+g+ +++e++Y+ +++ +k++      + +++++nk++e +++++a++
  VIMSS912936 259 DPEMVEIAKRNAEEVGLSDIIKFSVKDVNTLTIDTEEPVALIGNPPYGERIGDREEVEEMYRYIGKLMKQHPFL---STYILTSNKEFEYLVDRKATK 353
                  ********************************7777777*******************************6555...89******************* PP

                  EEEEEETTEEEEEE CS
      UPF0020 183 kvkeknvklglllk 196
                  ++k++n++++++++
  VIMSS912936 354 RRKLFNGYIECTYY 367
                  ***********986 PP



Or compare VIMSS912936 to CDD or PaperBLAST