PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS940096 to PF01170 (UPF0020)

VIMSS940096 has 365 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.1e-44  136.2   0.0    4.4e-43  133.4   0.0    2.0  1  VIMSS940096  


Domain annotation for each sequence (and alignments):
>> VIMSS940096  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  133.4   0.0   4.4e-43   4.4e-43       1     195 [.     191     358 ..     191     360 .. 0.96

  Alignments for each domain:
  == domain 1  score: 133.4 bits;  conditional E-value: 4.4e-43
                  -SSS-SS---SS-HHHHHHHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHHHH--EEEEES-HHHHHHHHHHHHH CS
      UPF0020   1 RgyRefngpapLketLAaalvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeearaelklygsDldrrvvqgareNaek 98 
                  R +R++++pa+Lk+++A al++la+ + g +++DP+CGsGtilIE al g +                          ++g+++ r++++ga+ Na +
  VIMSS940096 191 RPWRVYDHPAHLKASIANALIELAEPN-GGSFIDPFCGSGTILIELALRGYKGR------------------------IIGLEKYRKHIRGAEMNALS 263
                  78***********************97.56899*****************9999........................9******************* PP

                  TT-GGGEEEEE--GGG--STTS---EEEE----------HHHHHHHHHHHHHHHHHH-TT..-EEEEEESSHHHHHCC---ESEEEEEEETTEEEEE CS
      UPF0020  99 agvgdliefsqadaakLrlkegevdvivtnpPYGerlgskkalekLYseflrelkrvlrgggrlvlltsenkalekaleeralrkvkeknvklglll 195
                  agv d+ief q da+kL +  ++vd  v+n+PYG ++g+k ++ +LY +f +el++vl++  r v++t+e+ka+e+a+ ++ ++ ++ + + +g+l+
  VIMSS940096 264 AGVLDKIEFIQGDATKLSQYVESVDFAVSNLPYGLKIGRKSMIPRLYMAFFSELSKVLEK--RGVFITTEKKAIERAILDNGFKIKHHRLIGHGGLM 358
                  ******************8889**************************************..*********************99999988888876 PP



Or compare VIMSS940096 to CDD or PaperBLAST