PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS942114 to PF01170 (UPF0020)

VIMSS942114 has 306 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.8e-28   85.1   0.0    3.8e-27   81.4   0.0    2.0  1  VIMSS942114  


Domain annotation for each sequence (and alignments):
>> VIMSS942114  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   81.4   0.0   3.8e-27   3.8e-27       7     176 ..     134     279 ..     128     297 .. 0.87

  Alignments for each domain:
  == domain 1  score: 81.4 bits;  conditional E-value: 3.8e-27
                  S---SS-HHHHHHHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHHHH--EEEEES-HHHHHHHHHHHHHTT-GGG CS
      UPF0020   7 ngpapLketLAaalvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeearaelklygsDldrrvvqgareNaekagvgdl 104
                  +  ++L + LA al+rla+++pg + lDP+ GsGti++Eaa       p                       +y+ Dld++ +  are a + g++  
  VIMSS942114 134 ALRGSLTPVLAQALLRLADARPGMRVLDPFTGSGTIALEAASTLGPTSP-----------------------VYAGDLDEKRLGLAREAALASGLS-W 207
                  557899**********************************976555553.......................9**************999888876.6 PP

                  EEEEE--GGG--STTS---EEEE----------HHHHHHHHHHHHHHHHHH-TT..-EEEEEESSHHHHHCC CS
      UPF0020 105 iefsqadaakLrlkegevdvivtnpPYGerlgskkalekLYseflrelkrvlrgggrlvlltsenkalekal 176
                  i f  ada++L++   evd i++npP G rlg+k+ l +LY+ flr +   l  ggr +llt     l++al
  VIMSS942114 208 IRFLRADARHLPRFFPEVDRILANPPHGLRLGRKEGLFRLYRDFLRGALALLLPGGRVALLTLRPALLKRAL 279
                  788888******8888**************************************999999987776666655 PP



Or compare VIMSS942114 to CDD or PaperBLAST