WP_000031268.1 has 253 amino acids
Query: UPF0020 [M=197]
Accession: PF01170.22
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.9e-11 30.2 0.1 3.3e-11 29.3 0.1 1.4 1 WP_000031268.1
Domain annotation for each sequence (and alignments):
>> WP_000031268.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 29.3 0.1 3.3e-11 3.3e-11 75 126 .. 59 110 .. 28 113 .. 0.85
Alignments for each domain:
== domain 1 score: 29.3 bits; conditional E-value: 3.3e-11
UPF0020 75 aelklygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdviv 126
+ ++ g+D++++++++a+eN ++ag++ i+++qa+a kL+ +++++d+++
WP_000031268.1 59 YGCHIQGVDINKKALEKAQENISAAGLESYIQVQQANAVKLPFDDNQFDIVL 110
445699************************************88889*9986 PP
Or compare WP_000031268.1 to CDD or PaperBLAST