PaperBLAST – Find papers about a protein or its homologs

 

Align WP_000627762.1 to PF01170 (UPF0020)

WP_000627762.1 has 484 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.9e-10   26.9   0.0    3.3e-10   26.1   0.0    1.4  1  WP_000627762.1  


Domain annotation for each sequence (and alignments):
>> WP_000627762.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   26.1   0.0   3.3e-10   3.3e-10      20     144 ..     171     288 ..     166     343 .. 0.81

  Alignments for each domain:
  == domain 1  score: 26.1 bits;  conditional E-value: 3.3e-10
                     HHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHHHH--EEEEES-HHHHHHHHHHHHHTT-GGG.EEEEE--GG CS
         UPF0020  20 lvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeearaelklygsDldrrvvqgareNaekagvgdl.iefsqadaa 113
                     +v+l + +p++ ++DP  Gs ++l+  +   ++    l+      l + +++++++++ + g+D+dr +++ +  N    gv++  i++++    
  WP_000627762.1 171 IVELMKPTPEDIIVDPAAGSAGFLVSSGEYLRKNHSDLF------LVQGLKQHFNNDM-FHGFDMDRTMLRIGAMNMMLHGVENPnIQYQD-SLS 257
                     789999*********************998888885444......6666666666554.99*********************997255555.555 PP

                     G--STTS---EEEE----------HHHHHHH CS
         UPF0020 114 kLrlkegevdvivtnpPYGerlgskkalekL 144
                     + +++e+++ ++++npP+  +l+ +    +L
  WP_000627762.1 258 ESNKDEDKYTLVLANPPFKGSLDYEAVSADL 288
                     4555999***********9999877666555 PP



Or compare WP_000627762.1 to CDD or PaperBLAST