WP_000627762.1 has 484 amino acids
Query: UPF0020 [M=197] Accession: PF01170.22 Description: Putative RNA methylase family UPF0020 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-10 26.9 0.0 3.2e-10 26.1 0.0 1.4 1 WP_000627762.1 Domain annotation for each sequence (and alignments): >> WP_000627762.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 26.1 0.0 3.2e-10 3.2e-10 20 144 .. 171 288 .. 166 344 .. 0.80 Alignments for each domain: == domain 1 score: 26.1 bits; conditional E-value: 3.2e-10 UPF0020 20 lvrlagwkdgepllDPmCGsGtilIEaallganiapgllrefvyelkaeaeeearaelklygsDldrrvvqgareNaekagvgdl.iefsqadaa 113 +v+l + ++++ ++DP Gs ++l+ + ++ l+ l + +++++++++ + g+D+dr +++ + N gv++ i++++ WP_000627762.1 171 IVELMKPTPEDIIVDPAAGSAGFLVSSGEYLRKNHSDLF------LVQGLKQHFNNDM-FHGFDMDRTMLRIGAMNMMLHGVENPnIQYQD-SLS 257 789999*********************998888885444......6666666666554.99*********************997255555.555 PP UPF0020 114 kLrlkegevdvivtnpPYGerlgskkalekL 144 + +++e+++ ++++npP+ +l+ + +L WP_000627762.1 258 ESNKDEDKYTLVLANPPFKGSLDYEAVSADL 288 4555999***********9998877666555 PP
Or compare WP_000627762.1 to CDD or PaperBLAST