PaperBLAST – Find papers about a protein or its homologs

 

Align WP_001139701.1 to PF01170 (UPF0020)

WP_001139701.1 has 545 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.7e-10   27.0   0.0    7.1e-10   25.0   0.0    2.0  1  WP_001139701.1  


Domain annotation for each sequence (and alignments):
>> WP_001139701.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   25.0   0.0   7.1e-10   7.1e-10      78     144 ..     160     224 ..     132     251 .. 0.83

  Alignments for each domain:
  == domain 1  score: 25.0 bits;  conditional E-value: 7.1e-10
                     -EEEEES-HHHHHHHHHHHHHTT-GGGEEEEE--GGG--STTS---EEEE----------HHHHHHH CS
         UPF0020  78 klygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtnpPYGerlgskkalekL 144
                     ++yg D d+ +v+ +++  ++    d  +++q+d+ +L+  + ++d i tnpP+G++ +++++ e++
  WP_001139701.1 160 NIYGYDTDAFAVALTKKRIKERYHLDCPNIVQKDFLNLK-HTPQFDCIFTNPPWGKKYNQNQK-ENF 224
                     49*************************************.8889*************988764.444 PP



Or compare WP_001139701.1 to CDD or PaperBLAST