PaperBLAST – Find papers about a protein or its homologs

 

Align WP_010869937.1 to PF01170 (UPF0020)

WP_010869937.1 has 381 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.3e-78  248.5   0.0    2.9e-78  248.2   0.0    1.1  1  WP_010869937.1  


Domain annotation for each sequence (and alignments):
>> WP_010869937.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  248.2   0.0   2.9e-78   2.9e-78       1     196 [.     166     374 ..     166     375 .. 0.97

  Alignments for each domain:
  == domain 1  score: 248.2 bits;  conditional E-value: 2.9e-78
                     -SSS-SS---SS-HHHHHHHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SS..........HHHHHHHHHH...HH--EEEE CS
         UPF0020   1 RgyRefngpapLketLAaalvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvle..........lkaeaeeear...aelklygs 82 
                     RgyR+fn+pa+L++t+A++lv+l++wk++e+llDPmCGsGti+IE+al+++ni+pg++re+++           l++++++e+    + +k++g+
  WP_010869937.1 166 RGYRVFNHPAHLNATIASSLVYLSDWKDDEMLLDPMCGSGTIPIEGALMKRNIPPGKFRENKYGfkfidifgyeLLDKIKKEIVenkNIYKIIGL 260
                     9**************************************************************99*********89999888776668899**** PP

                     ES-HHHHHHHHHHHHHTT-GGGEEEEE--GGG--STTS---EEEE----------HHHHHHHHHHHHHHHHHH-TT..-EEEEEESSHHHHHCC- CS
         UPF0020  83 DldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtnpPYGerlgskkalekLYseflrelkrvlrgggrlvlltsenkalekale 177
                     D+++++++ga++Na++a+v d+ief + da+kL++k +e dvi++npPYG+r+gsk++++kLY+efl+++k++++g++rl+++t+e+k++++a++
  WP_010869937.1 261 DKNQKYLDGAKDNAKNAEVLDTIEFICGDATKLHEKFNESDVIIANPPYGIRIGSKRSVKKLYDEFLSSAKEIMHGSSRLIVITAEDKMFKDAIA 355
                     *********************************************************************************************** PP

                     --ESEEEEEEETTEEEEEE CS
         UPF0020 178 eralrkvkeknvklglllk 196
                     +++++ ++e+nv++g+l++
  WP_010869937.1 356 KNNFEVKEEFNVMFGGLMT 374
                     ***************9986 PP



Or compare WP_010869937.1 to CDD or PaperBLAST