PaperBLAST – Find papers about a protein or its homologs

 

Align WP_011012139.1 to PF01170 (UPF0020)

WP_011012139.1 has 365 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.8e-44  137.3   0.0    5.7e-43  133.0   0.0    2.1  1  WP_011012139.1  


Domain annotation for each sequence (and alignments):
>> WP_011012139.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  133.0   0.0   5.7e-43   5.7e-43       1     195 [.     191     358 ..     191     360 .. 0.95

  Alignments for each domain:
  == domain 1  score: 133.0 bits;  conditional E-value: 5.7e-43
                     -SSS-SS---SS-HHHHHHHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHHHH--EEEEES-HHHHHHHHHH CS
         UPF0020   1 RgyRefngpapLketLAaalvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeearaelklygsDldrrvvqgareN 95 
                     R +R++++pa+Lk+++A a+++la+++ g + lDPmCGsGtilIE al   +                          ++g+++ r+++ ga+ N
  WP_011012139.1 191 RPWRVYDHPAHLKASIANAMIELAELDGG-SVLDPMCGSGTILIELALRRYSGE------------------------IIGIEKYRKHLIGAEMN 260
                     78***********************9755.678*************99776666........................9**************** PP

                     HHHTT-GGGEEEEE--GGG--STTS---EEEE----------HHHHHHHHHHHHHHHHHH-TT..-EEEEEESSHHHHHCC---ESEEEEEEETT CS
         UPF0020  96 aekagvgdliefsqadaakLrlkegevdvivtnpPYGerlgskkalekLYseflrelkrvlrgggrlvlltsenkalekaleeralrkvkeknvk 190
                     a +agv d+i+f q da++L +  ++vd  ++n+PYG ++g+k ++ +LY +f +el++vl++  r v++t+e+ka+e+a++e+ ++ ++ + + 
  WP_011012139.1 261 ALAAGVLDKIKFIQGDATQLSQYVDSVDFAISNLPYGLKIGKKSMIPDLYMKFFNELAKVLEK--RGVFITTEKKAIEEAIAENGFEIIHHRVIG 353
                     *********************9999**************************************..***********************9999998 PP

                     EEEEE CS
         UPF0020 191 lglll 195
                     +g+l+
  WP_011012139.1 354 HGGLM 358
                     88876 PP



Or compare WP_011012139.1 to CDD or PaperBLAST