PaperBLAST – Find papers about a protein or its homologs

 

Align WP_013250207.1 to PF01170 (UPF0020)

WP_013250207.1 has 274 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.1e-10   27.7   0.0    2.1e-10   26.8   0.0    1.4  1  WP_013250207.1  


Domain annotation for each sequence (and alignments):
>> WP_013250207.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   26.8   0.0   2.1e-10   2.1e-10      75     128 ..     100     152 ..      89     154 .. 0.89

  Alignments for each domain:
  == domain 1  score: 26.8 bits;  conditional E-value: 2.1e-10
                     HH--EEEEES-HHHHHHHHHHHHHTT-GGGEEEEE--GGG--STTS---EEEE- CS
         UPF0020  75 aelklygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtn 128
                     ++ k yg+D+ +++++ areN ++agv++ +ef + ++ +L+l++ +vdvi++n
  WP_013250207.1 100 PTGKAYGVDMTEEMLALARENQRAAGVEN-VEFLKGEIEHLPLPDRSVDVIISN 152
                     55679**********************86.788899******99*********9 PP



Or compare WP_013250207.1 to CDD or PaperBLAST