PaperBLAST – Find papers about a protein or its homologs

 

Align WP_013651462.1 to PF01170 (UPF0020)

WP_013651462.1 has 512 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    9.2e-13   34.4   0.0    1.4e-12   33.8   0.0    1.3  1  WP_013651462.1  


Domain annotation for each sequence (and alignments):
>> WP_013651462.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   33.8   0.0   1.4e-12   1.4e-12      18     146 ..     176     298 ..     171     354 .. 0.84

  Alignments for each domain:
  == domain 1  score: 33.8 bits;  conditional E-value: 1.4e-12
                     HHHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHHHH--EEEEES-HHHHHHHHHHHHHTT-GGG.EEEEE-- CS
         UPF0020  18 aalvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeearaelklygsDldrrvvqgareNaekagvgdl.iefsqad 111
                     + +v+++  kp++ + DP  G+ ++l+ a+   ++  p l+r+ +l       ++  +e  + g+D+d  +++ +  N    gv++  +++++  
  WP_013651462.1 176 RLMVEMTAPKPTDAICDPAAGTCGFLVAAGEYLREKHPELMRDPAL-------RKHFHEGLFHGFDFDTTMLRIGAMNMTLHGVENPnVTYRDSL 263
                     569***********************************99977654.......333355669**********************98637888888 PP

                     GGG--STTS---EEEE----------HHHHHHHHH CS
         UPF0020 112 aakLrlkegevdvivtnpPYGerlgskkalekLYs 146
                     a +  ++ g + ++++npP+  +l+ + + ++L +
  WP_013651462.1 264 AEDHAEDAGAYSLVLANPPFAGSLDYEATAKDLQK 298
                     888889999***************99998888865 PP



Or compare WP_013651462.1 to CDD or PaperBLAST