PaperBLAST – Find papers about a protein or its homologs

 

Align WP_021034958.1 to PF01170 (UPF0020)

WP_021034958.1 has 251 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    3.7e-10   26.0   0.1    6.4e-10   25.2   0.1    1.4  1  WP_021034958.1  


Domain annotation for each sequence (and alignments):
>> WP_021034958.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   25.2   0.1   6.4e-10   6.4e-10      78     127 ..      63     112 ..      33     114 .. 0.87

  Alignments for each domain:
  == domain 1  score: 25.2 bits;  conditional E-value: 6.4e-10
                     -EEEEES-HHHHHHHHHHHHHTT-GGGEEEEE--GGG--STTS---EEEE CS
         UPF0020  78 klygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivt 127
                     ++ g+Dld+ ++++a+ N e+ g++++i+++  +a kL+ +++++d+++ 
  WP_021034958.1  63 HIEGVDLDEHALAKAQANIEANGLQEKIHVQRSNAMKLPFEDESFDIVIN 112
                     488************************************7777****995 PP



Or compare WP_021034958.1 to CDD or PaperBLAST