PaperBLAST – Find papers about a protein or its homologs

 

Align WP_021876510.1 to PF01170 (UPF0020)

WP_021876510.1 has 487 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.3e-11   30.7   0.0    2.7e-11   29.6   0.0    1.6  2  WP_021876510.1  


Domain annotation for each sequence (and alignments):
>> WP_021876510.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -3.7   0.0      0.45      0.45      66      86 ..      41      61 ..      31      63 .. 0.80
   2 !   29.6   0.0   2.7e-11   2.7e-11      19     144 ..     172     290 ..     167     348 .. 0.81

  Alignments for each domain:
  == domain 1  score: -3.7 bits;  conditional E-value: 0.45
                    HHHHHHHHHHH--EEEEES-H CS
         UPF0020 66 kaeaeeearaelklygsDldr 86
                    ++ +e+ ++ae+++ g+D++r
  WP_021876510.1 41 LDDIETTKEAEASILGIDFER 61
                    567888899999999999876 PP

  == domain 2  score: 29.6 bits;  conditional E-value: 2.7e-11
                     HHHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHHHH--EEEEES-HHHHHHHHHHHHHTT-GGG.EEEEE--G CS
         UPF0020  19 alvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeearaelklygsDldrrvvqgareNaekagvgdl.iefsqada 112
                      +v+l + +p++ ++DP  Gs ++l+   +  ++  +       l+l + ++e+++++  ++g+D+dr +++ +  N    gv++  ie+++   
  WP_021876510.1 172 MMVNLMKPTPEDIIVDPAAGSAGFLVSSQQYLRENHAN------LFLVQGLKEHFNNN-MFFGFDMDRTMLRIGAMNMMLHGVDNPnIEYKD-SL 258
                     59************************887766665533......34666666666654.499*********************986266666.77 PP

                     GG--STTS---EEEE----------HHHHHHH CS
         UPF0020 113 akLrlkegevdvivtnpPYGerlgskkalekL 144
                      +++ +++++ ++++npP+  +l+ +    +L
  WP_021876510.1 259 SEVNTDNDKFTLVLANPPFKGSLDYEAVSADL 290
                     88998999***********9999877666555 PP



Or compare WP_021876510.1 to CDD or PaperBLAST