PaperBLAST – Find papers about a protein or its homologs

 

Align WP_070365306.1 to PF01170 (UPF0020)

WP_070365306.1 has 235 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.9e-10   26.3   0.0    7.8e-10   24.9   0.0    1.7  1  WP_070365306.1  


Domain annotation for each sequence (and alignments):
>> WP_070365306.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   24.9   0.0   7.8e-10   7.8e-10      73     125 ..      63     115 ..      35     117 .. 0.91

  Alignments for each domain:
  == domain 1  score: 24.9 bits;  conditional E-value: 7.8e-10
                     HHHH--EEEEES-HHHHHHHHHHHHHTT-GGGEEEEE--GGG--STTS---EE CS
         UPF0020  73 araelklygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvi 125
                     a++++ ++g+D+ ++++ ++re+a++agv+d+ +f   daa L+ +++ +d++
  WP_070365306.1  63 AERDADIVGLDISQAMLSQGREKAKRAGVTDRLDFMRGDAARLPFPDNHFDAV 115
                     567888**************************************888899987 PP



Or compare WP_070365306.1 to CDD or PaperBLAST