WP_070365306.1 has 235 amino acids
Query: UPF0020 [M=197]
Accession: PF01170.22
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.9e-10 26.3 0.0 8e-10 24.8 0.0 1.7 1 WP_070365306.1
Domain annotation for each sequence (and alignments):
>> WP_070365306.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 24.8 0.0 8e-10 8e-10 73 125 .. 63 115 .. 36 117 .. 0.91
Alignments for each domain:
== domain 1 score: 24.8 bits; conditional E-value: 8e-10
UPF0020 73 araelklygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvi 125
a++++ ++g+D+ ++++ ++re+a++agv+d+ +f daa L+ +++ +d++
WP_070365306.1 63 AERDADIVGLDISQAMLSQGREKAKRAGVTDRLDFMRGDAARLPFPDNHFDAV 115
557888**************************************888899987 PP
Or compare WP_070365306.1 to CDD or PaperBLAST