PaperBLAST – Find papers about a protein or its homologs

 

Align WP_080713519.1 to PF01170 (UPF0020)

WP_080713519.1 has 447 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.9e-15   43.2   0.0    3.3e-15   42.4   0.0    1.4  1  WP_080713519.1  


Domain annotation for each sequence (and alignments):
>> WP_080713519.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   42.4   0.0   3.3e-15   3.3e-15      20     148 ..     175     297 ..     169     352 .. 0.82

  Alignments for each domain:
  == domain 1  score: 42.4 bits;  conditional E-value: 3.3e-15
                     HHHHTT--TTS-EEETT-TTSHHHHHHHHHHTT--TTTT----SSHHHHHHHHHHHH--.EEEEES-HHHHHHHHHHHHHTT-GG.GEEEEE--G CS
         UPF0020  20 lvrlagwkpgepllDPmCGsGtilIEaallganiapgllrefvlelkaeaeeearaelk.lygsDldrrvvqgareNaekagvgd.liefsqada 112
                     +v +   +p++++ DP CG+ ++lI a   +++  p +l        +  + + +++ + + g+D+d+ +++ a  N    g+++ ++++++   
  WP_080713519.1 175 MVDMVAPQPTDTICDPACGTAGFLIGASEYVRDHHPEAL--------TDQQLRHHYHHEmFHGFDFDSTMLRIASMNMLLHGIEGaEVQYRDSLS 261
                     999999*********************999999998665........4445555544446***********************873577777777 PP

                     GG--STTS---EEEE----------HHHHHHHHHHH CS
         UPF0020 113 akLrlkegevdvivtnpPYGerlgskkalekLYsef 148
                          +eg++ ++++npP+  +l+ + + ++L + +
  WP_080713519.1 262 EGAADDEGSYSLVLANPPFAGSLDYESTSKDLQQVV 297
                     77778999****************999999997764 PP



Or compare WP_080713519.1 to CDD or PaperBLAST