WP_107356363.1 has 280 amino acids
Query: UPF0020 [M=197]
Accession: PF01170.22
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.3e-10 25.4 0.0 9.2e-10 24.6 0.0 1.3 1 WP_107356363.1
Domain annotation for each sequence (and alignments):
>> WP_107356363.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 24.6 0.0 9.2e-10 9.2e-10 78 128 .. 104 153 .. 91 154 .. 0.89
Alignments for each domain:
== domain 1 score: 24.6 bits; conditional E-value: 9.2e-10
UPF0020 78 klygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtn 128
+ yg+D+ ++++ ar+N +kagv+ +ef + ++ +++l++++vdvi++n
WP_107356363.1 104 NAYGLDMTDEMLALARDNQRKAGVD-NVEFLKGEIEAIPLPDNSVDVIISN 153
589********************96.6899999******9999*******9 PP
Or compare WP_107356363.1 to CDD or PaperBLAST