PaperBLAST – Find papers about a protein or its homologs

 

Align WP_107356363.1 to PF01170 (UPF0020)

WP_107356363.1 has 280 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    5.6e-10   25.4   0.0    9.5e-10   24.6   0.0    1.3  1  WP_107356363.1  


Domain annotation for each sequence (and alignments):
>> WP_107356363.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   24.6   0.0   9.5e-10   9.5e-10      78     128 ..     104     153 ..      91     154 .. 0.89

  Alignments for each domain:
  == domain 1  score: 24.6 bits;  conditional E-value: 9.5e-10
                     -EEEEES-HHHHHHHHHHHHHTT-GGGEEEEE--GGG--STTS---EEEE- CS
         UPF0020  78 klygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtn 128
                     + yg+D+  ++++ ar+N +kagv+  +ef + ++ +++l++++vdvi++n
  WP_107356363.1 104 NAYGLDMTDEMLALARDNQRKAGVD-NVEFLKGEIEAIPLPDNSVDVIISN 153
                     589********************96.6899999******99*********9 PP



Or compare WP_107356363.1 to CDD or PaperBLAST