XP_752977.1 has 253 amino acids
Query: UPF0020 [M=197]
Accession: PF01170.22
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.7e-10 25.6 0.0 1.3e-09 24.2 0.0 1.6 1 XP_752977.1
Domain annotation for each sequence (and alignments):
>> XP_752977.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 24.2 0.0 1.3e-09 1.3e-09 76 128 .. 90 141 .. 79 142 .. 0.87
Alignments for each domain:
== domain 1 score: 24.2 bits; conditional E-value: 1.3e-09
UPF0020 76 elklygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtn 128
e + +g+D+ r +v+ a++Nae+ag+ ++ +a +++++l++++vd i++n
XP_752977.1 90 EGNAIGIDMTRDMVDLAKTNAEAAGLPNTRF-IEASITSIPLPDASVDCIISN 141
55689**********************9865.5569****************9 PP
Or compare XP_752977.1 to CDD or PaperBLAST