PaperBLAST – Find papers about a protein or its homologs

 

Align XP_752977.1 to PF01170 (UPF0020)

XP_752977.1 has 253 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.18
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    5.2e-10   25.5   0.0    1.4e-09   24.1   0.0    1.6  1  XP_752977.1  


Domain annotation for each sequence (and alignments):
>> XP_752977.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   24.1   0.0   1.4e-09   1.4e-09      76     128 ..      90     141 ..      79     142 .. 0.87

  Alignments for each domain:
  == domain 1  score: 24.1 bits;  conditional E-value: 1.4e-09
                  H--EEEEES-HHHHHHHHHHHHHTT-GGGEEEEE--GGG--STTS---EEEE- CS
      UPF0020  76 elklygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtn 128
                  e + +g+D+ r +v+ a++Nae+ag+ ++    +a +++++l++++vd i++n
  XP_752977.1  90 EGNAIGIDMTRDMVDLAKTNAEAAGLPNTRF-IEASITSIPLPDASVDCIISN 141
                  55689**********************9865.5569****************9 PP



Or compare XP_752977.1 to CDD or PaperBLAST