PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6581401 to PF01205 (UPF0029)

VIMSS6581401 has 170 amino acids

Query:       UPF0029  [M=105]
Accession:   PF01205.19
Description: Uncharacterized protein family UPF0029
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    2.4e-38  117.0   0.1    3.5e-38  116.5   0.1    1.3  1  VIMSS6581401  


Domain annotation for each sequence (and alignments):
>> VIMSS6581401  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  116.5   0.1   3.5e-38   3.5e-38       1     105 []      21     163 ..      21     163 .. 0.96

  Alignments for each domain:
  == domain 1  score: 116.5 bits;  conditional E-value: 3.5e-38
                   TTEEEEEEEEE-SSHHHHHHHHHHH--..TT...SSEE.EEEE....EE......................................TTEE-TTSST CS
       UPF0029   1 kkSrFiavlaaveseeevkaileelkkenkk...athn.iyAyrlrqkvek..................................vnedsdddgEpa 59 
                   +kS+F+a+++++++++++++il+el ++nk+   a+h  +yA+r++++ ++                                  +++++ d+gE++
  VIMSS6581401  21 RKSKFQARCCPLQNQKDIPSILQELTQNNKSvskASHMhMYAWRTAEVSNNlhlqqeqkkkgnkanksnnshvnksrnitvqpknIEQGCADCGEAG 117
                   79*************************9998999***88******999988***********************999999999988888******** PP

                   SHHHHHHHHHHTTB-SEEEEEEEE--SS--HHHHHHHHHHHHHHHH CS
       UPF0029  60 AGkkllelLekeklenvlvvvtRwfGGikLGpgrlraiseaareaL 105
                   AG++ll+lLe++++ nvlv+vtRw+GG+ LG++r+r+is++a e+L
  VIMSS6581401 118 AGQRLLTLLERANIFNVLVIVTRWYGGTPLGSSRFRHISTCAVETL 163
                   ******************************************9876 PP



Or compare VIMSS6581401 to CDD or PaperBLAST