PaperBLAST – Find papers about a protein or its homologs

 

Align NP_713742.2 to PF01458 (UPF0051)

NP_713742.2 has 407 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.9e-61  193.6   0.1    2.6e-61  193.2   0.1    1.1  1  NP_713742.2  


Domain annotation for each sequence (and alignments):
>> NP_713742.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  193.2   0.1   2.6e-61   2.6e-61       9     218 .]     160     378 ..     150     378 .. 0.94

  Alignments for each domain:
  == domain 1  score: 193.2 bits;  conditional E-value: 2.6e-61
      UPF0051   9 vveegaevtiieey.........agcgvveifvgenAklkyvkvqnwsedavnlstkraeegrdaklelttvslggkltrkepsvelkgegaeaelng 97 
                   ++ + ++ i+e+y         + +g + +  g+++k++yv +++ +++++++++   ++++d++l++ +v+ gg+   + ++v+l+g+ga+a++ g
  NP_713742.2 160 KIGSHNKILIVERYecieeqelkFFQGLSVLQTGAGSKVSYVGIESFGSSIFHFQNLFSDQREDSDLKIAKVTPGGYKGKNLLNVDLSGKGARARVIG 257
                  566777778888887766555554459999******************************************************************** PP

      UPF0051  98 lylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHgAtvGkidee 195
                  l+  ++++++d+++k+ hn+ +t+s il++++lk++a+ +f g++++ + ++  +a q n+nLll++++ra++iP+le++a++vk++HgAtvG+idee
  NP_713742.2 258 LAPMAAREFQDSEVKIVHNESHTESSILYRSALKNKAHHIFTGNLRIPNSCKDVNAIQINNNLLLNRTSRAESIPKLEVYAENVKCEHGATVGEIDEE 355
                  ************************************************************************************************** PP

      UPF0051 196 qlfYLmsRGlseeeArrlivrgf 218
                  qlfYL sRG++e+eArr+iv gf
  NP_713742.2 356 QLFYLASRGIDEDEARRMIVDGF 378
                  **********************9 PP



Or compare NP_713742.2 to CDD or PaperBLAST