PaperBLAST – Find papers about a protein or its homologs

 

Align P77522 to PF01458 (UPF0051)

P77522 has 495 amino acids

Query:       UPF0051  [M=218]
Accession:   PF01458.17
Description: Uncharacterized protein family (UPF0051)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    6.4e-73  231.1   0.2    8.1e-73  230.8   0.2    1.1  1  P77522    


Domain annotation for each sequence (and alignments):
>> P77522  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  230.8   0.2   8.1e-73   8.1e-73       2     218 .]     234     466 ..     233     466 .. 0.97

  Alignments for each domain:
  == domain 1  score: 230.8 bits;  conditional E-value: 8.1e-73
  UPF0051   2 qfertlivveegaevtiieeyagc............gvveifvgenAklkyvkvqnw......sedavnlstkra.eegrdaklelttvslggkltrkepsv 84 
              qfert++v++e++ v++i   +gc            +vve+++++nA++ky++vqnw       ++++n++tkra  eg+++k+++t+ ++g+++t+k+ps+
   P77522 234 QFERTILVADEDSYVSYI---EGCsapvrdsyqlhaAVVEVIIHKNAEVKYSTVQNWfpgdnnTGGILNFVTKRAlCEGENSKMSWTQSETGSAITWKYPSC 332
              89****************...677777777777777*************************9777**********87799********************** PP

  UPF0051  85 elkgegaeaelnglylakgkqhldtrtkvdhngpntssrilskgvlkdearavfrgkikvrkgaqktdahqenrnLllsdkaradtiPeleidaddvkasHg 186
               l+g+++ +e+++++l++g+q++dt+tk++h g+nt+s+i+skg++++++++++rg +k+ + a++++++++++++l++ ++ a+t+P++e++++ ++++H+
   P77522 333 ILRGDNSIGEFYSVALTSGHQQADTGTKMIHIGKNTKSTIISKGISAGHSQNSYRGLVKIMPTATNARNFTQCDSMLIGANCGAHTFPYVECRNNSAQLEHE 434
              ****************************************************************************************************** PP

  UPF0051 187 AtvGkideeqlfYLmsRGlseeeArrlivrgf 218
              At+++i e+qlfY+ +RG+see+A ++iv+gf
   P77522 435 ATTSRIGEDQLFYCLQRGISEEDAISMIVNGF 466
              *******************************9 PP



Or compare P77522 to CDD or PaperBLAST